PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10002477m
Common NameCARUB_v10002477mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 390aa    MW: 45118.4 Da    PI: 9.7384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10002477mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.88.8e-124588148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEdell +av+++ g+ +Wk+    +g +R + qc++rw+k+l
  Carubv10002477m 45 KGGWTSEEDELLTNAVQRYKGHnSWKK----IG-KRNDVQCQHRWLKVL 88
                     688*****************999****....56.6666********986 PP

2Myb_DNA-binding49.41e-1594143148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Edell ++v+ + ++   +W++I++ ++ gR +kqc++rw+++l
  Carubv10002477m  94 KGPWTKKEDELLSKLVNDHIKNdkpQWSKISKQLP-GRIGKQCRERWHNHL 143
                      79******************99*************.*************97 PP

3Myb_DNA-binding48.81.6e-15150191245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        WT eE+++lv+  +++G++ W+ Ia+ ++ gRt++++k++w+
  Carubv10002477m 150 TVWTREEELILVQSQREHGNK-WEEIAKLLP-GRTENNIKNHWN 191
                      67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.1524088IPR017877Myb-like domain
SMARTSM007174.9E-74490IPR001005SANT/Myb domain
PfamPF002493.3E-94588IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-154799IPR009057Homeodomain-like
CDDcd001671.99E-84888No hitNo description
SuperFamilySSF466897.76E-1770135IPR009057Homeodomain-like
PROSITE profilePS5129425.38789147IPR017930Myb domain
SMARTSM007171.6E-1693145IPR001005SANT/Myb domain
CDDcd001671.42E-1196143No hitNo description
PfamPF139217.8E-1597157No hitNo description
Gene3DG3DSA:1.10.10.601.7E-23100151IPR009057Homeodomain-like
SuperFamilySSF466891.79E-27123200IPR009057Homeodomain-like
PROSITE profilePS5129418.525148198IPR017930Myb domain
SMARTSM007171.2E-14148196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-19152198IPR009057Homeodomain-like
CDDcd001671.64E-10152191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MTEEYSDLSR SESEYDDITA EVTPTFAIDS PRYKRVSGAK RRSTKGGWTS EEDELLTNAV  60
QRYKGHNSWK KIGKRNDVQC QHRWLKVLDP SLYKGPWTKK EDELLSKLVN DHIKNDKPQW  120
SKISKQLPGR IGKQCRERWH NHLNPTIKKT VWTREEELIL VQSQREHGNK WEEIAKLLPG  180
RTENNIKNHW NCSVKKRLEQ FPSNLVSDVL YDPRPHGFEY NFFNHKTLQM EEAATSTQWD  240
SLELTLGPMN WRSTPSSTSS LRGDDTISSS SLESDWSSPK ESTVETPQHN NENGCIQEVK  300
KIKERLRMAA STFNTPSIIS KRSSPTSSGL KRHRQKDDTQ FHVDARSHKS SEEVHSNIST  360
SPFSKYRLAK RNTCSGSKPL ERRLDFDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-52481989159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-52481989159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289074.10.0hypothetical protein CARUB_v10002477mg
TrEMBLR0FHY70.0R0FHY7_9BRAS; Uncharacterized protein
STRINGAT4G00540.11e-174(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__3646__AT4G00540.21e-174(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00540.21e-170myb domain protein 3r2